Error message

  • Notice: Undefined variable: cmd in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).
  • Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 33 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 33 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 33 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 33 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 33 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 34 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 35 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 36 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 39 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 39 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 39 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 39 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 40 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 41 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 42 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 96 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined offset: 0 in include() (line 99 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 99 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined offset: 0 in include() (line 106 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 106 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined offset: 0 in include() (line 107 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 107 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 108 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 108 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 109 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 109 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: derives from in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 115 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: mRNA in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).

TCONS_00001264 (transcript) - C. hemisphaerica

Overview
NameTCONS_00001264
Unique NameTCONS_00001264
Typetranscript
OrganismClytia hemisphaerica (Jellyfish)
Sequence length4315

Sequence
The following sequences are available for this feature:

transcript sequence

>TCONS_00001264 ID=TCONS_00001264|Name=TCONS_00001264|organism=Clytia hemisphaerica|type=transcript|length=4315bp
CAAAGACGGAAGTGTAAGATGCCTTCTAACAGAAACAGTAGTATACAAAT
CGAAGAAAGATCGAGTCGATGATGGAGGTAGAGCTGGTAGAGGAGATAGG
TTTttatatcttaatttttttgcaaatattcTTCCTTTACTTTTACCCAA
TGATGATATGGCTACACCCATGGTGTAGAAAACGACGTGGCAAATGGTAC
CATTGGAGATTGTACTATTTTCTCTatgcatttggttggttgatattcgc
TTTACCATCGCACAACTTCAGCAAGACATATTATATGGTAGTTGGCTCGG
TCATTCATATAACCATTGTACCGTTCATTTTGGGTTGTCGTCGGTACAGA
AAGCGAAAAGAAGATTTGAATgcgaaaatgaaagaactagctGCTTTGAA
ACCACAAGTCATTACAATTTGTAAAGTCACTGAGCCTCGTTCTTCGTGCT
GCGCAAAACAACAAATCATTTGGAGAGAACAGAAAGAATTCGAGTACCGA
CATTGGATAGATCTAACTGACCAATATTCAGTCGAATTGGAACCACNGCT
GCGCAAAACAACAAATCATTTTGAGAGAACAGAAAGAATTCGAGTACCGA
CATTGGATAGATCTAACTGACCAATATTCAGTCGAACTGGAACCACAGAT
GAAAAACATGGTCGAAGgtgaattgaaaattgaaatagaaTTCGATGACG
GTGAAACGAGGGAATCTTATATTCAACATGTCCAAAATCTTCGAAATGAA
TTGCCACAATATTGCCAAAATGCTCACATTTCTACTAAACGTGTTTTCAA
AGTCGATGAAAGGGATATCGAATCTATCGAAAGATCGTTTTATGGAAGCC
ACATGCAACCATTATTCCTTTTAAAACTCGTTCATCCACAGATAGAATTT
TCTTTCAGAGTGGTGAATTGGTTTCTTCAAAAGTTTGGGTCGAAGAAATT
ATTGACTAAAGAAATTATCATCAAGAAGGTTATTTCTGACAGAACTATTG
AAGCTCTTTGAACATGATGATGTATTTACCGAAAGAAGGAAATCAAAAGT
TGATGATGGAATCCCATTCCATCAACTATTTTGAAGGATAAAGGAAACTG
CAACCTTAGCAACGCTCTATTGATCCTTTTTGTTACTCGTTTTTagatca
tttttttttattatctatTTTGAGCACTAGAAAAAATGATTTAAGCCCTC
TTGCATCCATATTAATGACTTATTTTCATAGACTTTCATAGACAAGCCAA
ATTGGTTTTTTTATCTAACTCGTCTGCGTTAGCTATCAAGAAATAAGAAA
TGCATCGATCCATCTTTTGTCTTTAaagaacatattttttttaatgaatg
aGCATGCGTGAAATGTATTTTGACATGCGGTTGCCATGGAAAGAATATAT
CGGGGATGTCACAAACAAGCATGGAAGCTGTCAGAAAACACGCcaggaga
aaaatgaagatagggaagatgaaaacgaaaaaaaagagaaaacatttttg
gtttgaaaatggaagaAAGAAGGTCTGAAAAATATGCACTGATATGTgcG
ATACTTCTAACTATAGTTGGTGGTTCATGGTCCTTGGCCAACAACACAAT
AAACTCACAACAAAACACTACAGTTACTGAGACAGTATGTTGGAACATCA
CTTGCAACAGCAGTGAGAAGTGTTCAACAACGATTACTCTCAACACTACA
ACATCCACCCTTCTTCAACTGGACAACCAAACATGCTTTCGAGCAGATTG
TATGGATTTGAAGTGCGCTCAACAATACCTCAAACAAACAGTGTCGCTAC
CGATGAAGGAAAGTTGTGTCGAAATGTCATGTCTCAACACGTCTTGTATC
GAAGATACCATCTCAAACACCAGTTGTTTTCCAAAACAAACATCGACCTC
TGCACCAACGACTACAACNGACATCAGTTGTTTTCCAAAACCAACCTCAA
CCTCTGCACCAACGACTacaaccacaacaacaaaaTCCATGCAACAACTA
CGCCAAGAAGAGTGCGACCAATACAAATACTGGCTATTCAAAAACAAATG
TTCGTCGCGCTTCAGTTTGTGTGCAAAGGACGTCTTTCTCAATATGAGTC
AACATATTGAATGCTTAGAAGAGAAGGGAACTCAACATTACAAATACCCT
GCTGCGCCAATGTTGTTAATCTACCATTTGATCAAATATACCAAAGTCTT
TATGAAGGATGAAGTGCTGAAAATGATCAAGAAAACGCCTTTCCCGATTG
AGGTCTTCAAAAAGTTAGTTTGGTATGGCGAAGAATCGTTCCGCATGTCT
GATATTGTATTACCCGGTTATCATAAGAACCCGTTCAAACGATCGCGGCG
ACGTTGGAACGGGATTAACGATACGCTAACCGTGCCTTACGGGAACATCC
TACGTGGCGATTTCATCTATAACTTTGCCATGTTTGATCAAGTGGTCGTg
gcaaaacaagaaaaagagaaatatcGATTGAAAGACAACTGGCCTGACCA
GCATCCAATCTCAAATGGAGAATACATCAGTTTCAGAAGCGAAACCGGAT
GGAAGCACTATACTAATCACGTGATCAACTCAATAGTGGTCACTTTCGAT
ATCGAGCCAGCGATGGCTGAGCTTCCCACGTACAACACCATCGCGTTTAC
ACACAAGGATCGGAAAATGGTCAATCCAATCTGCGTATATTGGCAACCGT
TGAATGCTGGCAAAGAAGGAGCGGACCCAGAAGCAGGATATTGGACCAAT
TACCATATGAAGATattgaaaaccaacaaatcgATGACCGTTTGCAAAGC
GTATACTTTTGGTTCGTTCGCTGTACTGATGGAACCATACGTACCAAAAA
ATAACAGCCAACCTCTGGATGTCACCGAGATTCTCTTCCTAGCGTTTATC
TCGTTCTCCGCCCTCCTTCAACTGGTGTATTTGGCGGGGATGTTCTCCTT
GAAGTGCCATAAGAATAGCGCTAACAGATTGTATATTTACGCAAACCTCA
GTCTGTTCATGATGCAAGTATTGATCGTTTTCTCCTTCCGCCATCGTGAC
GATTGGGAAAAGTGTGCTATATATACAGGTTGGATACAGTTCTTTTTCAT
CAACATATTGAGTTGGCTAATGATGGAGAGTGTACATCGCTTGTCGAATC
TCCTTCATTTCTTCCACAAAGACACCAACAGAGATTTCTTATATCACATC
GTCGGCCTGGGTATCCCCCTTTCCAATATGATTGCAATGCAAGGTTTCCC
GTATGACGAGTACAGCTCACTCCGCATCTGTTGGGTGTACGCCAACGACT
TACGGCTTTGGTATTTCATCAACCCTATCACAGCCATCATTTGTGCCAGC
TTCTTAATCAAGTTCATCACCTTCAAGAAATATCAAGGCCAGGATAAGTT
TCTAGAGAATGATTTCAACTACCAGCAAGCGCAGTTGAGTGTGTTTGCCA
CCGGAGCCATCTTACCCACCCTCCTGATCGGCTGGACCTTGATGAGCGTG
TCAGTGCGCACTGAAGCAAAATTGCAGAATTTTCTTCTCATCGCAGCATC
TATCGCTCAAGTATGTCTTGGATTGCAAGTGCTTTACTTTTATTTCTACC
GCAACCATTGGGTGGTGGAAGCGATGACCGAGGAGAAACGTATCAAGGAG
AAAAAGAAGTTGACCACCTTATCTTTCTTGAAAGGACTTCCCATTCGTAT
ACGTTACAAGGACAATCCTTATGACGCAATGGAGGAGAAAAGTGAGGACT
CGTACGAAATGAGATACACTTCATCTTCATCTCTTGGCGATGAAATCATG
TTAGACGAAAGTGTTTATTGACTCCTTCATCTCATTCATTTAACCTTTTA
ATGTAATTTTGTTAGACAGAGACGAGTAATAGCAGTCTAAAGCAGACCTT
CTGTATGAAACACTGTTGAGAAACACTGATGAACTTGCACTGAGTAAAGA
ACTGCATCTTATATACCGTTTTTAACACTTTGCGTAAGATACATATTAGA
AAGTGCATGTTTATGGGTGCGGAGAAAGCAAATTACTACGAAAATTGAAA
TCGAACGAGAAAAAACGTTGCGAGTTGAatgaattatttcaaaatataat
ataaatcaTATAAATCTTTTAGTGGGTTTTTCTTCCATGTTATAATTTGT
TTATTATTCAGTAGTGAGTAGCTAACTTTTGATGTACATAGATGTCATGA
ATAAATCATTCCACTAATATATTCAAATGGTATGAATCAAAAGGCTAAGG
TTAGttcattctatttttatctGGGTTGAATCCGAACATTGAAAGGTTAC
CAGGTGACAATGAAA
Run BLAST on NCBI

protein sequence of TCONS_00001264-protein

>TCONS_00001264-protein ID=TCONS_00001264-protein|Name=TCONS_00001264-protein|organism=Clytia hemisphaerica|type=polypeptide|length=770bp
MEERRSEKYALICAILLTIVGGSWSLANNTINSQQNTTVTETVCWNITCN
SSEKCSTTITLNTTTSTLLQLDNQTCFRADCMDLKCAQQYLKQTVSLPMK
ESCVEMSCLNTSCIEDTISNTSCFPKQTSTSAPTTTXDISCFPKPTSTSA
PTTTTTTTKSMQQLRQEECDQYKYWLFKNKCSSRFSLCAKDVFLNMSQHI
ECLEEKGTQHYKYPAAPMLLIYHLIKYTKVFMKDEVLKMIKKTPFPIEVF
KKLVWYGEESFRMSDIVLPGYHKNPFKRSRRRWNGINDTLTVPYGNILRG
DFIYNFAMFDQVVVAKQEKEKYRLKDNWPDQHPISNGEYISFRSETGWKH
YTNHVINSIVVTFDIEPAMAELPTYNTIAFTHKDRKMVNPICVYWQPLNA
GKEGADPEAGYWTNYHMKILKTNKSMTVCKAYTFGSFAVLMEPYVPKNNS
QPLDVTEILFLAFISFSALLQLVYLAGMFSLKCHKNSANRLYIYANLSLF
MMQVLIVFSFRHRDDWEKCAIYTGWIQFFFINILSWLMMESVHRLSNLLH
FFHKDTNRDFLYHIVGLGIPLSNMIAMQGFPYDEYSSLRICWVYANDLRL
WYFINPITAIICASFLIKFITFKKYQGQDKFLENDFNYQQAQLSVFATGA
ILPTLLIGWTLMSVSVRTEAKLQNFLLIAASIAQVCLGLQVLYFYFYRNH
WVVEAMTEEKRIKEKKKLTTLSFLKGLPIRIRYKDNPYDAMEEKSEDSYE
MRYTSSSSLGDEIMLDESVY
Run BLAST on NCBI

transcript from alignment at sc0000007:1402001..1407047-

Legend: exonfive_prime_UTRCDSthree_prime_UTR
Hold the cursor over a type above to highlight its positions in the sequence below.
>TCONS_00001264 ID=TCONS_00001264|Name=TCONS_00001264|organism=Clytia hemisphaerica|type=transcript|length=5047bp|location=Sequence derived from alignment at sc0000007:1402001..1407047- (Clytia hemisphaerica)
CAAAGACGGAAGTGTAAGATGCCTTCTAACAGAAACAGTAGTATACAAAT CGAAGAAAGATCGAGTCGATGATGGAGGTAGAGCTGGTAGAGGAGATAGG TTTTTATATCTTAATTTTTTTGCAAATATTCTTCCTTTACTTTTACCCAA TGATGATATGGCTACACCCATGGTGTAGAAAACGACGTGGCAAATGGTAC CATTGGAGATTGTACTATTTTCGTAAGTAGTATCAATTTCATGAAATACT TTTTGCCAAGAATATTTATTGTGATTTTAATTTAAAGTTAACAAATCAAC TGTCAAGCCGGTCTTTAAGAAAATATCAACAGGATCTTTAACGTAAAGGG CAACAATGCAGACAGGTGCAACATCGGTAAGTAAACGTTGGAAAGTCGAT CTCTCAAAATGACATCGGTTACTTAGGTTGCTCGTTCATTGACAGTCTTG AAAAAGTCATCAATGTTTATCGGTAGGAATAATAATACACTATACACTAC ATTATAGTACCGTAATACAAACCAAATCTTCTTTTAATATTTCAGTCTAT GCATTTGGTTGGTTGATATTCGCTTTACCATCGCACAACTTCAGCAAGAC ATATTATATGGTAGTTGGCTCGGTCATTCATATAACCATTGTACCGTTCA TTTTGGGTTGTCGTCGGTACAGAAAGCGAAAAGAAGATTTGAATGCGAAA ATGAAAGAACTAGCTGCTTTGAAACCACAAGTCATTACAATTTGTAAAGT CACTGAGCCTCGTTCTTCGTGCTGCGCAAAACAACAAATCATTTGGAGAG AACAGAAAGAATTCGAGTACCGACATTGGATAGATCTAACTGACCAATAT TCAGTCGAATTGGAACCACNGCTGCGCAAAACAACAAATCATTTTGAGAG AACAGAAAGAATTCGAGTACCGACATTGGATAGATCTAACTGACCAATAT TCAGTCGAACTGGAACCACAGATGAAAAACATGGTCGAAGGTGAATTGAA AATTGAAATAGAATTCGATGACGGTGAAACGAGGGAATCTTATATTCAAC ATGTCCAAAATCTTCGAAATGAATTGCCACAATATTGCCAAAATGCTCAC ATTTCTACTAAACGTGTTTTCAAAGTCGATGAAAGGGATATCGAATCTAT CGAAAGATCGTTTTATGGAAGCCACATGCAACCATTATTCCTTTTAAAAC TCGTTCATCCACAGATAGAATTTTCTTTCAGAGTGGTGAATTGGTTTCTT CAAAAGTTTGGGTCGAAGAAATTATTGACTAAAGAAATTATCATCAAGAA GGTTATTTCTGACAGAACTATTGAAGCTCTTTGAACATGATGTATTTACC GAAAGAAGGTAACCAAAAGTTGATGATGGAATCCNTGAAGCTCTTTGAAC ATGATGATGTATTTACCGAAAGAAGGAAATCAAAAGTTGATGATGGAATC CCATTCCATCAACTATTTTGAAGGATAAAGGAAACTGCAACCTTAGCAAC GCTCTATTGATCCTTTTTGTTACTCGTTTTTAGATCATTTTTTTTTATTA TCTATTTTGAGCACTAGAAAAAATGATTTAAGCCCTCTTGCATCCATATT AATGACTTATTTTCATAGACTTTCATAGACAAGCCAAATTGGTTTTTTTA TCTAACTCGTCTGCGTTAGCTATCAAGAAATAAGAAATGCATCGATCCAT CTTTTGTCTTTAAAGAACATATTTTTTTTAATGAATGAGCATGCGTGAAA TGTATTTTGACATGCGGTTGCCATGGAAAGAATATATCGGGGATGTCACA AACAAGCATGGAAGCTGTCAGAAAACACGCCAGGAGAAAAATGAAGATAG GGAAGATGAAAACGAAAAAAAAGAGAAAACATTTTTGGTTTGAAAATGGA AGAAAGAAGGTCTGAAAAATATGCACTGATATGTGTAAGTCTGTTTTTTG TTATTGACGGTTACTAATATTTGCGGTGCGGTAATTTTAGACTTGAATTG GATTCAATTTCAGTTGTTGTTTAAATTATCTAAGCTCAGCGGGAGCTCAC TTGCGTAATTTAGAGCCCAATTCTGTAAAACTTCGAAATTTTAGTCTCAG TTAATTGTTTGTATCTTCTAAAACAAAATCTCCGATTCAGATACGTTTCA GATCAACTACTTTTTAAGTACAAAATTTGGATCTACTTAGTNGATACGTT TCAGATCAACTACCTTTTAGGTACAAAATTTGGATCTACTTAGTTGCAAA ATTCTAAGCATATTCATTTTTAATTTTAGGCGATACTTCTAACTATAGTT GGTGGTTCATGGTCCTTGGCCAACAACACAATAAACTCACAACAAAACAC TACAGTTACTGAGACAGTATGTTGGAACATCACTTGCAACAGCAGTGAGA AGTGTTCAACAACGATTACTCTCAACACTACAACATCCACCCTTCTTCAA CTGGACAACCAAACATGCTTTCGAGCAGATTGTATGGATTTGAAGTGCGC TCAACAATACCTCAAACAAACAGTGTCGCTACCGATGAAGGAAAGTTGTG TCGAAATGTCATGTCTCAACACGTCTTGTATCGAAGATACCATCTCAAAC ACCAGTTGTTTTCCAAAACAAACATCGACCTCTGCACCAACGACTACAAC NGACATCAGTTGTTTTCCAAAACCAACCTCAACCTCTGCACCAACGACTA CAACCACAACAACAAAATCCATGCAACAACTACGCCAAGAAGAGTGCGAC CAATACAAATACTGGCTATTCAAAAACAAATGTTCGTCGCGCTTCAGTTT GTGTGCAAAGGACGTCTTTCTCAATATGAGTCAACATATTGAATGCTTAG AAGAGAAGGGAACTCAACATTACAAATACCCTGCTGCGCCAATGTTGTTA ATCTACCATTTGATCAAATATACCAAAGTCTTTATGAAGGATGAAGTGCT GAAAATGATCAAGAAAACGCCTTTCCCGATTGAGGTCTTCAAAAAGTTAG TTTGGTATGGCGAAGAATCGTTCCGCATGTCTGATATTGTATTACCCGGT TATCATAAGAACCCGTTCAAACGATCGCGGCGACGTTGGAACGGGATTAA CGATACGCTAACCGTGCCTTACGGGAACATCCTACGTGGCGATTTCATCT ATAACTTTGCCATGTTTGATCAAGTGGTCGTGGCAAAACAAGAAAAAGAG AAATATCGATTGAAAGACAACTGGCCTGACCAGCATCCAATCTCAAATGG AGAATACATCAGTTTCAGAAGCGAAACCGGATGGAAGCACTATACTAATC ACGTGATCAACTCAATAGTGGTCACTTTCGATATCGAGCCAGCGATGGCT GAGCTTCCCACGTACAACACCATCGCGTTTACACACAAGGATCGGAAAAT GGTCAATCCAATCTGCGTATATTGGCAACCGTTGAATGCTGGCAAAGAAG GAGCGGACCCAGAAGCAGGATATTGGACCAATTACCATATGAAGATATTG AAAACCAACAAATCGATGACCGTTTGCAAAGCGTATACTTTTGGTTCGTT CGCTGTACTGATGGAACCATACGTACCAAAAAATAACAGCCAACCTCTGG ATGTCACCGAGATTCTCTTCCTAGCGTTTATCTCGTTCTCCGCCCTCCTT CAACTGGTGTATTTGGCGGGGATGTTCTCCTTGAAGTGCCATAAGAATAG CGCTAACAGATTGTATATTTACGCAAACCTCAGTCTGTTCATGATGCAAG TATTGATCGTTTTCTCCTTCCGCCATCGTGACGATTGGGAAAAGTGTGCT ATATATACAGGTTGGATACAGTTCTTTTTCATCAACATATTGAGTTGGCT AATGATGGAGAGTGTACATCGCTTGTCGAATCTCCTTCATTTCTTCCACA AAGACACCAACAGAGATTTCTTATATCACATCGTCGGCCTGGGTATCCCC CTTTCCAATATGATTGCAATGCAAGGTTTCCCGTATGACGAGTACAGCTC ACTCCGCATCTGTTGGGTGTACGCCAACGACTTACGGCTTTGGTATTTCA TCAACCCTATCACAGCCATCATTTGTGCCAGCTTCTTAATCAAGTTCATC ACCTTCAAGAAATATCAAGGCCAGGATAAGTTTCTAGAGAATGATTTCAA CTACCAGCAAGCGCAGTTGAGTGTGTTTGCCACCGGAGCCATCTTACCCA CCCTCCTGATCGGCTGGACCTTGATGAGCGTGTCAGTGCGCACTGAAGCA AAATTGCAGAATTTTCTTCTCATCGCAGCATCTATCGCTCAAGTATGTCT TGGATTGCAAGTGCTTTACTTTTATTTCTACCGCAACCATTGGGTGGTGG AAGCGATGACCGAGGAGAAACGTATCAAGGAGAAAAAGAAGTTGACCACC TTATCTTTCTTGAAAGGACTTCCCATTCGTATACGTTACAAGGACAATCC TTATGACGCAATGGAGGAGAAAAGTGAGGACTCGTACGAAATGAGATACA CTTCATCTTCATCTCTTGGCGATGAAATCATGTTAGACGAAAGTGTTTAT TGACTCCTTCATCTCATTCATTTAACCTTTTAATGTAATTTTGTTAGACA GAGACGAGTAATAGCAGTCTAAAGCAGACCTTCTGTATGAAACACTGTTG AGAAACACTGATGAACTTGCACTGAGTAAAGAACTGCATCTTATATACCG TTTTTAACACTTTGCGTAAGATACATATTAGAAAGTGCATGTTTATGGGT GCGGAGAAAGCAAATTACTACGAAAATTGAAATCGAACGAGAAAAAACGT TGCGAGTTGAATGAATTATTTCAAAATATAATATAAATCATATAAATCTT TTAGTGGGTTTTTCTTCCATGTTATAATTTGTTTATTATTCAGTAGTGAG TAGCTAACTTTTGATGTACATAGATGTCATGAATAAATCATTCCACTAAT ATATTCAAATGGTATGAATCAAAAGGCTAAGGTTAGTTCATTCTATTTTT ATCTGGGTTGAATCCGAACATTGAAAGGTTACCAGGTGACAATGAAA

Coding sequence (CDS) from alignment at sc0000007:1402001..1407047-

>TCONS_00001264 ID=TCONS_00001264|Name=TCONS_00001264|organism=Clytia hemisphaerica|type=CDS|length=4626bp|location=Sequence derived from alignment at sc0000007:1402001..1407047- (Clytia hemisphaerica)
GCGATACTTCTAACTATAGTTGGTGGTTCATGGTCCTTGGCCAACAACAC
AATAAACTCACAACAAAACACTACAGTTACTGAGACAGTATGTTGGAACA
TCACTTGCAACAGCAGTGAGAAGTGTTCAACAACGATTACTCTCAACACT
ACAACATCCACCCTTCTTCAACTGGACAACCAAACATGCTTTCGAGCAGA
TTGTATGGATTTGAAGTGCGCTCAACAATACCTCAAACAAACAGTGTCGC
TACCGATGAAGGAAAGTTGTGTCGAAATGTCATGTCTCAACACGTCTTGT
ATCGAAGATACCATCTCAAACACCAGTTGTTTTCCAAAACAAACATCGAC
CTCTGCACCAACGACTACAACNGACATCAGTTGTTTTCCAAAACCAACCT
CAACCTCTGCACCAACGACTACAACCACAACAACAAAATCCATGCAACAA
CTACGCCAAGAAGAGTGCGACCAATACAAATACTGGCTATTCAAAAACAA
ATGTTCGTCGCGCTTCAGTTTGTGTGCAAAGGACGTCTTTCTCAATATGA
GTCAACATATTGAATGCTTAGAAGAGAAGGGAACTCAACATTACAAATAC
CCTGCTGCGCCAATGTTGTTAATCTACCATTTGATCAAATATACCAAAGT
CTTTATGAAGGATGAAGTGCTGAAAATGATCAAGAAAACGCCTTTCCCGA
TTGAGGTCTTCAAAAAGTTAGTTTGGTATGGCGAAGAATCGTTCCGCATG
TCTGATATTGTATTACCCGGTTATCATAAGAACCCGTTCAAACGATCGCG
GCGACGTTGGAACGGGATTAACGATACGCTAACCGTGCCTTACGGGAACA
TCCTACGTGGCGATTTCATCTATAACTTTGCCATGTTTGATCAAGTGGTC
GTGGCAAAACAAGAAAAAGAGAAATATCGATTGAAAGACAACTGGCCTGA
CCAGCATCCAATCTCAAATGGAGAATACATCAGTTTCAGAAGCGAAACCG
GATGGAAGCACTATACTAATCACGTGATCAACTCAATAGTGGTCACTTTC
GATATCGAGCCAGCGATGGCTGAGCTTCCCACGTACAACACCATCGCGTT
TACACACAAGGATCGGAAAATGGTCAATCCAATCTGCGTATATTGGCAAC
CGTTGAATGCTGGCAAAGAAGGAGCGGACCCAGAAGCAGGATATTGGACC
AATTACCATATGAAGATATTGAAAACCAACAAATCGATGACCGTTTGCAA
AGCGTATACTTTTGGTTCGTTCGCTGTACTGATGGAACCATACGTACCAA
AAAATAACAGCCAACCTCTGGATGTCACCGAGATTCTCTTCCTAGCGTTT
ATCTCGTTCTCCGCCCTCCTTCAACTGGTGTATTTGGCGGGGATGTTCTC
CTTGAAGTGCCATAAGAATAGCGCTAACAGATTGTATATTTACGCAAACC
TCAGTCTGTTCATGATGCAAGTATTGATCGTTTTCTCCTTCCGCCATCGT
GACGATTGGGAAAAGTGTGCTATATATACAGGTTGGATACAGTTCTTTTT
CATCAACATATTGAGTTGGCTAATGATGGAGAGTGTACATCGCTTGTCGA
ATCTCCTTCATTTCTTCCACAAAGACACCAACAGAGATTTCTTATATCAC
ATCGTCGGCCTGGGTATCCCCCTTTCCAATATGATTGCAATGCAAGGTTT
CCCGTATGACGAGTACAGCTCACTCCGCATCTGTTGGGTGTACGCCAACG
ACTTACGGCTTTGGTATTTCATCAACCCTATCACAGCCATCATTTGTGCC
AGCTTCTTAATCAAGTTCATCACCTTCAAGAAATATCAAGGCCAGGATAA
GTTTCTAGAGAATGATTTCAACTACCAGCAAGCGCAGTTGAGTGTGTTTG
CCACCGGAGCCATCTTACCCACCCTCCTGATCGGCTGGACCTTGATGAGC
GTGTCAGTGCGCACTGAAGCAAAATTGCAGAATTTTCTTCTCATCGCAGC
ATCTATCGCTCAAGTATGTCTTGGATTGCAAGTGCTTTACTTTTATTTCT
ACCGCAACCATTGGGTGGTGGAAGCGATGACCGAGGAGAAACGTATCAAG
GAGAAAAAGAAGTTGACCACCTTATCTTTCTTGAAAGGACTTCCCATTCG
TATACGTTACAAGGACAATCCTTATGACGCAATGGAGGAGAAAAGTGAGG
ACTCGTACGAAATGAGATACACTTCATCTTCATCTCTTGGCGATGAAATC
ATGTTAGACGAAAGTGTTTATTGAATGGAAGAAAGAAGGTCTGAAAAATA
TGCACTGATATGTGCGATACTTCTAACTATAGTTGGTGGTTCATGGTCCT
TGGCCAACAACACAATAAACTCACAACAAAACACTACAGTTACTGAGACA
GTATGTTGGAACATCACTTGCAACAGCAGTGAGAAGTGTTCAACAACGAT
TACTCTCAACACTACAACATCCACCCTTCTTCAACTGGACAACCAAACAT
GCTTTCGAGCAGATTGTATGGATTTGAAGTGCGCTCAACAATACCTCAAA
CAAACAGTGTCGCTACCGATGAAGGAAAGTTGTGTCGAAATGTCATGTCT
CAACACGTCTTGTATCGAAGATACCATCTCAAACACCAGTTGTTTTCCAA
AACAAACATCGACCTCTGCACCAACGACTACAACNGACATCAGTTGTTTT
CCAAAACCAACCTCAACCTCTGCACCAACGACTACAACCACAACAACAAA
ATCCATGCAACAACTACGCCAAGAAGAGTGCGACCAATACAAATACTGGC
TATTCAAAAACAAATGTTCGTCGCGCTTCAGTTTGTGTGCAAAGGACGTC
TTTCTCAATATGAGTCAACATATTGAATGCTTAGAAGAGAAGGGAACTCA
ACATTACAAATACCCTGCTGCGCCAATGTTGTTAATCTACCATTTGATCA
AATATACCAAAGTCTTTATGAAGGATGAAGTGCTGAAAATGATCAAGAAA
ACGCCTTTCCCGATTGAGGTCTTCAAAAAGTTAGTTTGGTATGGCGAAGA
ATCGTTCCGCATGTCTGATATTGTATTACCCGGTTATCATAAGAACCCGT
TCAAACGATCGCGGCGACGTTGGAACGGGATTAACGATACGCTAACCGTG
CCTTACGGGAACATCCTACGTGGCGATTTCATCTATAACTTTGCCATGTT
TGATCAAGTGGTCGTGGCAAAACAAGAAAAAGAGAAATATCGATTGAAAG
ACAACTGGCCTGACCAGCATCCAATCTCAAATGGAGAATACATCAGTTTC
AGAAGCGAAACCGGATGGAAGCACTATACTAATCACGTGATCAACTCAAT
AGTGGTCACTTTCGATATCGAGCCAGCGATGGCTGAGCTTCCCACGTACA
ACACCATCGCGTTTACACACAAGGATCGGAAAATGGTCAATCCAATCTGC
GTATATTGGCAACCGTTGAATGCTGGCAAAGAAGGAGCGGACCCAGAAGC
AGGATATTGGACCAATTACCATATGAAGATATTGAAAACCAACAAATCGA
TGACCGTTTGCAAAGCGTATACTTTTGGTTCGTTCGCTGTACTGATGGAA
CCATACGTACCAAAAAATAACAGCCAACCTCTGGATGTCACCGAGATTCT
CTTCCTAGCGTTTATCTCGTTCTCCGCCCTCCTTCAACTGGTGTATTTGG
CGGGGATGTTCTCCTTGAAGTGCCATAAGAATAGCGCTAACAGATTGTAT
ATTTACGCAAACCTCAGTCTGTTCATGATGCAAGTATTGATCGTTTTCTC
CTTCCGCCATCGTGACGATTGGGAAAAGTGTGCTATATATACAGGTTGGA
TACAGTTCTTTTTCATCAACATATTGAGTTGGCTAATGATGGAGAGTGTA
CATCGCTTGTCGAATCTCCTTCATTTCTTCCACAAAGACACCAACAGAGA
TTTCTTATATCACATCGTCGGCCTGGGTATCCCCCTTTCCAATATGATTG
CAATGCAAGGTTTCCCGTATGACGAGTACAGCTCACTCCGCATCTGTTGG
GTGTACGCCAACGACTTACGGCTTTGGTATTTCATCAACCCTATCACAGC
CATCATTTGTGCCAGCTTCTTAATCAAGTTCATCACCTTCAAGAAATATC
AAGGCCAGGATAAGTTTCTAGAGAATGATTTCAACTACCAGCAAGCGCAG
TTGAGTGTGTTTGCCACCGGAGCCATCTTACCCACCCTCCTGATCGGCTG
GACCTTGATGAGCGTGTCAGTGCGCACTGAAGCAAAATTGCAGAATTTTC
TTCTCATCGCAGCATCTATCGCTCAAGTATGTCTTGGATTGCAAGTGCTT
TACTTTTATTTCTACCGCAACCATTGGGTGGTGGAAGCGATGACCGAGGA
GAAACGTATCAAGGAGAAAAAGAAGTTGACCACCTTATCTTTCTTGAAAG
GACTTCCCATTCGTATACGTTACAAGGACAATCCTTATGACGCAATGGAG
GAGAAAAGTGAGGACTCGTACGAAATGAGATACACTTCATCTTCATCTCT
TGGCGATGAAATCATGTTAGACGAAAGTGTTTATTGAATGGAAGAAAGAA
GGTCTGAAAAATATGCACTGATATGT
Gene-mRNA-Prot
This transcript is a part of the following gene feature(s):
Feature NameUnique NameSpeciesType
XLOC_000671XLOC_000671Clytia hemisphaericagene
The following polypeptide feature(s) derives from this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001264-proteinTCONS_00001264-proteinClytia hemisphaericapolypeptide
The following exon feature(s) are a part of this transcript:
Feature NameUnique NameSpeciesType
TCONS_00001264-exon-sc0000007-1575043694:1406826..1407047TCONS_00001264-exon-sc0000007-1575043694:1406826..1407047Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1575043694:1405712..1406502TCONS_00001264-exon-sc0000007-1575043694:1405712..1406502Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1575043694:1405114..1405647TCONS_00001264-exon-sc0000007-1575043694:1405114..1405647Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1575043694:1402001..1404768TCONS_00001264-exon-sc0000007-1575043694:1402001..1404768Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1510915933:1406826..1407047TCONS_00001264-exon-sc0000007-1510915933:1406826..1407047Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1510915933:1405712..1406502TCONS_00001264-exon-sc0000007-1510915933:1405712..1406502Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1510915933:1405114..1405647TCONS_00001264-exon-sc0000007-1510915933:1405114..1405647Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1510915933:1402001..1404768TCONS_00001264-exon-sc0000007-1510915933:1402001..1404768Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1491911889:1406826..1407047TCONS_00001264-exon-sc0000007-1491911889:1406826..1407047Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1491911889:1405712..1406502TCONS_00001264-exon-sc0000007-1491911889:1405712..1406502Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1491911889:1405114..1405647TCONS_00001264-exon-sc0000007-1491911889:1405114..1405647Clytia hemisphaericaexon
TCONS_00001264-exon-sc0000007-1491911889:1402001..1404768TCONS_00001264-exon-sc0000007-1491911889:1402001..1404768Clytia hemisphaericaexon
Position
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
sc0000007supercontigsc0000007:1402001..1407047 -
Expression

Hover the mouse over a column in the graph to view expression values in transcripts per million (tpm).
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset | Show/Hide Values

Values :
    GrOo_1	 GrOo_2	 FGOo_1	 FGOo_2	 EG_1	 EG_2	 P1_1	 P1_2	 P2_1	 P2_2	 P3_1	 P3_2	 PoPr_1	 PoPr_2	 St_1	 St_2	 GO_1	 GO_2	 PH_1	 PH_2	 BMF_1	 BMF_2	 MMF_1	 MMF_2	 M_1	 M_2	 GEC_1	 GEC_2	 GEN_1	 GEN_2
0 0.0642344 0.058293 0.0668869 0 0 0 0 0 0 0 0 0.232635 0.137246 0 0.00874201 0.346689 0.211467 0.689498 0.707286 0.690439 0.794506 2.4461 5.01505 5.11799 7.77459 0.585165 0.915206 0 0.0164368
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR000203GPS
IPR000832GPCR_2_secretin-like
IPR017981GPCR_2-like
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
Vocabulary: Biological Process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO Annotation
GO Assignments
This transcript is annotated with the following GO terms.
Category Term Accession Term Name
biological_process GO:0007166 cell surface receptor signaling pathway
biological_process GO:0007186 G-protein coupled receptor signaling pathway
cellular_component GO:0016021 integral component of membrane
molecular_function GO:0004930 G-protein coupled receptor activity
molecular_function GO:0004888 transmembrane signaling receptor activity
Blast
BLAST of TCONS_00001264 vs. Swiss-Prot (Human)
Match: AGRL3 (Adhesion G protein-coupled receptor L3 OS=Homo sapiens GN=ADGRL3 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.891e-18
Identity = 106/460 (23.04%), Postives = 179/460 (38.91%), Query Frame = 3
Query: 2562 TNH--VINSIVVTFDIEPAMAEL-----PTYNTIAFTHKDRKMVNPICVYWQPLNAGKEGADPEAGYWTNYHMKILKTNKSMTVCKAYTFGSFAVLMEPYVPKNNSQPLDVTEXXXXXXXXXXXXXQLVYLAGMFSLKC-----------HKNSANRLYIYANL--SLFMMQVLIVFSFRHRDDWEKCAIYTGWIQFFFINILSWLMMESVHRLSNLLHFFHKDTNRDFLYHIVGLGIPLSNMIAMQGFPYDEYSSLRICWVYANDLRLWYFINPITAIICASFLIKFITFKKYQGQDKFLENDFNYQQAQLSVFATGAILPTLLIGWT----LMSVSVRTEAKLQNFLLIAASIAQVCLGLQVLYFYFY----------------RNHWVVEAMTEEK--RIKEKKKLTTLSFLKGLPIRIRYKDNPYDAMEEKSEDSY-EMRYTSSSSLGDEIMLDES 3812
            TNH  ++NS V+T  I    +       P   T+    +  +  NP C +W              GYW+    ++L TNK+ T C      +FAVLM     K++    D+             L  + ++  + SL C               ++R  I+ NL  SLF+ ++L +      D    CA++   + FFF+   +W+ +E V     L+  F  + +R   +++VG G+P   +       Y  Y + ++CW+  +   +W FI P T II  + +   I   K       L+ +       +  +  GAI    L+G T    LM ++  T        +I A +  +   LQ ++ + +                R H      TE      K     T   +  G   RIR   N  D + ++SE S+      SS+SL  E +L+ +
Sbjct:  758 TNHSVIVNSPVITAAINKEFSNKVYLADPVVFTVKHIKQSEENFNPNCSFW------SYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNHLTNFAVLMAHVEVKHSDAVHDL------------LLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIMLNVIFLGIALYKMFHHTAILKPESGCLD-NIKSWVIGAIALLCLLGLTWAFGLMYINEST--------VIMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHCCSGKSTESSIGSGKTSGSRTPGRYSTGSQSRIRRMWN--DTVRKQSESSFITGDINSSASLNREGLLNNA 1188          
The following BLAST results are available for this feature:
BLAST of TCONS_00001264 vs. Swiss-Prot (Human)
Analysis Date: 2017-10-03 (blastx Clytia hemisphaerica v1.0 mRNA vs SwissProt (Homo sapiens))
Total hits: 1
Match NameE-valueIdentityDescription
AGRL31.891e-1823.04Adhesion G protein-coupled receptor L3 OS=Homo sap... [more]
back to top