Overview
Sequence
The following sequences are available for this feature:
polypeptide sequence >TCONS_00072790-protein ID=TCONS_00072790-protein|Name=TCONS_00072790-protein|organism=Clytia hemisphaerica|type=polypeptide|length=253bpRun BLAST on NCBI Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Annotated Terms
The following terms have been associated with this polypeptide:
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
Blast
BLAST of TCONS_00072790-protein vs. Swiss-Prot (Human)
Match: NFYA (Nuclear transcription factor Y subunit alpha OS=Homo sapiens GN=NFYA PE=1 SV=2) HSP 1 Score: 113.235 bits (282), Expect = 1.651e-29 Identity = 53/76 (69.74%), Postives = 59/76 (77.63%), Query Frame = 0 Query: 110 QRVPV-AMEALDE-PLYVNAKQYHRIIKRRQARAKLEAEGKIPKTRKKYLHESRHLHAVRRNRSMGGRFVGKPNMD 183 QR+P+ E L+E PLYVNAKQYHRI+KRRQARAKLEAEGKIPK R+KYLHESRH HA+ R R GGRF D Sbjct: 250 QRIPLPGAEMLEEEPLYVNAKQYHRILKRRQARAKLEAEGKIPKERRKYLHESRHRHAMARKRGEGGRFFSPKEKD 325 The following BLAST results are available for this feature:
BLAST of TCONS_00072790-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens)) Total hits: 1
|