Error message

  • Notice: Undefined variable: cmd in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).
  • Warning: shell_exec(): Cannot execute a blank command in include() (line 59 of /var/www/marimba/sites/default/modules/tripal_cvterm/theme/templates/tripal_feature_cvterm.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 4 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_base.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 4 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_base.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 5 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_base.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 6 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_base.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 28 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 29 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 30 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 31 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: part of in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 45 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined property: stdClass::$subject_id in include() (line 68 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined property: stdClass::$subject_id in include() (line 71 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined offset: 0 in include() (line 81 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 81 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined offset: 0 in include() (line 84 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 84 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 96 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 108 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 108 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined variable: prot in include() (line 109 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 109 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant transcript - assumed 'transcript' in include() (line 113 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: part of in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 413 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Use of undefined constant mRNA - assumed 'mRNA' in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Undefined index: part of in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).
  • Notice: Trying to get property of non-object in include() (line 417 of /var/www/marimba/sites/all/themes/sea_theme/tripal_feature_relationships.tpl.php).

TCONS_00001302-protein (polypeptide) - C. hemisphaerica

Overview
NameTCONS_00001302-protein
Unique NameTCONS_00001302-protein
Typepolypeptide
OrganismClytia hemisphaerica (Jellyfish)
Sequence length259

Sequence
The following sequences are available for this feature:

polypeptide sequence

>TCONS_00001302-protein ID=TCONS_00001302-protein|Name=TCONS_00001302-protein|organism=Clytia hemisphaerica|type=polypeptide|length=259bp
NLKAPSDTTAEKLVQNYFDYSMNGGKGKLRMRVGLNVCVKIFYVLVNVMS
FVFTDDLLNGNFKSYGLEWLKWSKLNNSLAFAYTRTRAHPKPGNMLLPAM
GLCDITEGVKDVRHSFTNYNKFICEISPHILYQYVLVVLWFLLIISIVIS
NIGVIINMFSLSYIMLSCRESRNVSRNTRNIVKRVRRNLTIREIEYLQFI
RVKNLAMFGEVVRFLQARAEQRHAHNFEVHETRQRSQHQSFEKPSYGKQT
SLLLRNTKS
Run BLAST on NCBI
Gene-mRNA-Prot
This polypeptide comes from the following gene feature:
Feature NameUnique NameSpeciesType
XLOC_000706XLOC_000706Clytia hemisphaericagene
This polypeptide derives from the following transcript feature(s):
Feature NameUnique NameSpeciesType
TCONS_00001302TCONS_00001302Clytia hemisphaericatranscript
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: Cellular Component
TermDefinition
GO:0005921gap junction
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0005921 gap junction
InterPro
Analysis Name: InterPro Annotations of C. hemisphaerica v1.0
Date Performed: 2017-06-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPFAMPF00876Innexincoord: 31..212
e-value: 1.2E-7
score: 31.3

Blast
The following BLAST results are available for this feature:
BLAST of TCONS_00001302-protein vs. Swiss-Prot (Human)
Analysis Date: 2018-01-31 (Blastp Clytia hemisphaerica v1.0 proteins vs SwissProt (Homo sapiens))
Total hits: 0
Match NameE-valueIdentityDescription
back to top